Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized human LIF at 2 μg/ml can bind human LIFR (CSB-MP012929HUi9), the EC50 is 22.58-30.24 ng/ml.
Alternative Names
(LIF)(Differentiation-stimulating factor)(D factor)(Melanoma-derived LPL inhibitor)(MLPLI)(Emfilermin)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
23-202aa
Target Protein Sequence
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant Human LIF is a full-length mature protein derived from mammalian cells, featuring the 23-202aa expression region of the Leukemia inhibitory factor. This protein plays a significant role in cancer research and is equipped with a C-terminal hFc-tag. The purity of LIF is greater than 90% as assessed by SDS-PAGE, and its endotoxin level is less than 1.0 EU/µg, as determined by the LAL method. The activity of this protein is measured by its binding ability in a functional ELISA, where immobilized human LIF at 2 µg/ml can bind human LIFR (CSB-MP012929HUi9) with an EC50 value of 22.58-30.24 ng/ml. The lyophilized powder format ensures easy storage and handling for a wide range of research applications.