Recombinant Human Leukemia inhibitory factor (LIF) (Active)

In Stock
Code CSB-MP012928HUd9
MSDS
Size $228
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized human LIF at 2 μg/ml can bind human LIFR (CSB-MP012929HUi9), the EC50 is 22.58-30.24 ng/ml. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized human LIF at 2 μg/ml can bind human LIFR (CSB-MP012929HUi9), the EC50 is 22.58-30.24 ng/ml.
Target Names
LIF
Uniprot No.
Research Area
Cancer
Alternative Names
(LIF)(Differentiation-stimulating factor)(D factor)(Melanoma-derived LPL inhibitor)(MLPLI)(Emfilermin)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
23-202aa
Target Protein Sequence
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Mol. Weight
48.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human LIF is a full-length mature protein derived from mammalian cells, featuring the 23-202aa expression region of the Leukemia inhibitory factor. This protein plays a significant role in cancer research and is equipped with a C-terminal hFc-tag. The purity of LIF is greater than 90% as assessed by SDS-PAGE, and its endotoxin level is less than 1.0 EU/µg, as determined by the LAL method. The activity of this protein is measured by its binding ability in a functional ELISA, where immobilized human LIF at 2 µg/ml can bind human LIFR (CSB-MP012929HUi9) with an EC50 value of 22.58-30.24 ng/ml. The lyophilized powder format ensures easy storage and handling for a wide range of research applications.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
Gene References into Functions
  1. miR-181c-3p and -5p promotes high-glucose-induced dysfunction in human umbilical vein endothelial cells by regulating leukemia inhibitory factor PMID: 29605252
  2. The findings indicate that low LIF concentrations in serum and follicular fluid may contribute to disordered folliculogenesis in polycystic ovary syndrome. PMID: 29397316
  3. This study uses LIF to activate the PI3K/ AKT signal and induce the anti-inflammatory effect during the neuron differentiation from human induced pluripotent stem cell-derived neural precursor cells. PMID: 29393372
  4. These findings implicate ZEB1 as a stem cell regulator in glioma via LIF repression which when deleted leads to increased stemness, tumorigenicity and shortened patient survival. PMID: 28246407
  5. Decreased serum LIF levels may be associated with vasculopathy in systemic sclerosis (SSc) and that Fli1 deficiency may contribute to the inhibition of LIF-dependent biological effects on SSc endothelial cells by suppressing the expression of LIF, LIF receptor, and gp130. PMID: 29038846
  6. The endometrial expression of LIF and CD34 in the pathogenesis of non-developing pregnancy can be used for evaluating the pregnancy prognosis in women of young and old reproductive age. PMID: 29063331
  7. This report describes the involvement of proteins responsible for cell growth and progression and defines the LIF-mediated novel autocrine-paracrine signaling loop for cell growth arrest. PMID: 28755912
  8. The expression of LIF was associated with tumor size and a poorer overall survival. Microarray and quantitative real-time polymerase chain reaction assessments suggest that LIF can facilitate tumor-promoting inflammation. Results indicate that LIF plays a role in maintaining cancer stem cells in chordomas. PMID: 28247842
  9. study indicated impaired LIF expression levels only in women with unexplained infertility, while LIF-R expression was impaired in all sub-groups of infertile women. PMID: 28432985
  10. findings illustrate that DeltaNp63alpha can inhibit the levels of LIF mRNA by direct transcription regulation and decrease LIF mRNA stability by suppressing the expression of Lnc-LIF-AS. An inverse interaction of LIF and DeltaNp63alpha expression was as well validated in clinical samples of cervical cancer, and high level of LIF in cervical cancers was related with poor patient survival. PMID: 28391028
  11. ATF3 plays a significant role in regulating human endometrial receptivity and embryo attachment in vitro via up-regulation of leukemia inhibitory factor. PMID: 28577574
  12. Although further studies would be required to deconvolute the targets involved in LIF induction and to confirm activity of hits in more disease-relevant assays, our results have demonstrated the potential of the phenotypic approach to identify specific and chemically tractable small molecules that trigger the production of LIF in relevant cell lines PMID: 26984928
  13. SNP 3951C/T of LIF may not be associated with in vitro fertilization and embryo transfer outcome in Iranian population. PMID: 28466814
  14. In summary, this study has shown that LIF is implicated in the HG-mediated inhibition of osteoblast differentiation, via promoting STAT3/SOCS3 signaling. This study may provide insights into the signal pathway of HG-induced bone loss or delayed injured joint healing. PMID: 28064096
  15. Cytokines of the LIF/CNTF family and metabolism PMID: 26817395
  16. These results demonstrate the involvement of PIM kinases in LIF-induced regulation in different trophoblastic cell lines which may indicate similar functions in primary cells. PMID: 28729093
  17. Data suggest a 216-nucleotide proximal cis-element in LIF mRNA exhibits mRNA destabilizing potential; on exposure to carcinogen PMA (phorbol-12-myristate-13-acetate), this cis-element exhibits mRNA stabilizing activity. PMA induces nucleo-cytoplasmic translocation of both nucleolin and PCBP1, 2 trans-acting factors that bind to and stabilize LIF mRNA. [LIF = leukemia inhibitory factor; PCBP1 = poly(rC) binding protein 1] PMID: 28512205
  18. Leukemia inhibitory factor (LIF) - STAT3 transcription factor (STAT3) signaling pathway is systemically dysregulated in in the endometrium of patients with recurrent/repeated implantation failure (RIFE). PMID: 27304912
  19. Endometrial expression of LIF and LIFR is significantly reduced in the epithelial cells of infertile women. PMID: 27082016
  20. LIF SNP T/G (rs929271) seems to be a susceptibility biomarker capable of predicting implantation efficiency and pregnancy outcomes. PMID: 26615902
  21. Overexpression of LIF promotes Epithelial-mesenchymal transition and results in cancer. PMID: 26716902
  22. This review discusses the role of LIF and the recent analysis of its action on the uterine LE in regulating endometrial receptivity and implantation. PMID: 26817565
  23. Women with dormant genital tuberculosis were found to have decreased endometrial LIF-STAT3 signaling. PMID: 26776907
  24. Data show that leukemia inhibitory factor (LIF) signaling promote chemoresistance in cholangiocarcinoma by up-regulating myeloid cell factor-1 (Mcl-1) via phosphatidylinositol 3-kinase (PI3K)/c-akt protein (AKT)-dependent pathway. PMID: 26296968
  25. Despite common signal transduction mechanisms (JAK/STAT, MAPK and PI3K) LIF can have paradoxically opposite effects in different cell types including stimulating or inhibiting each of cell proliferation, differentiation and survival. PMID: 26187859
  26. Taken together, we firstly demonstrate that LIF enhances the adhesion of trophoblastic cells to endometrial cells by up-regulating expression of integrin heterodimer alphaVbeta3 and alphaVbeta5. PMID: 26723254
  27. LIF has a role in negatively regulating tumour-suppressor p53 through Stat3/ID1/MDM2 in colorectal cancers PMID: 25323535
  28. LIF/p21 signaling cascade as a novel tumor suppressive-like pathway in melanoma, acting downstream of TGFbeta to regulate cell cycle arrest and cell death, further highlight new potential therapeutic strategies for the treatment of cutaneous melanoma PMID: 25885043
  29. LIF was frequently overexpressed in osteosarcoma, which could promote the growth and invasion through activating the STAT3 pathway. PMID: 26271643
  30. LIF structure, signaling pathway, and primary roles in the development and function of an organism are reviewed--{REVIEW} PMID: 25879318
  31. LIF downregulates the autoimmune response by enhancing Treg numbers. PMID: 25514345
  32. LIF mediates fibroblast activation to promote invasive tumor microenvironment. PMID: 24857661
  33. Data indicate that NanoLuc-fusion strategy provided an efficient approach for preparation of recombinant leukemia inhibitory factor (LIF) protein PMID: 25179300
  34. Expression of LIF protects the lung from lung injury and enhanced pathology during respiratory syncytial virus infection. PMID: 25277705
  35. Studied the association of tubal pregnancy with leukemia inhibitory factor (LIF) and leukemia inhibitory factor receptor (LIFR) expression in oviduct tissues. PMID: 25790555
  36. an essential function of Foxm1 in the LIF/Stat3-mediated mESC self-renewal and the generation of iPSCs PMID: 24743237
  37. Results show that endogenous levels of Pkig reciprocally regulate osteoblast and adipocyte differentiation and that this reciprocal regulation is mediated in part by LIF. PMID: 23963683
  38. An increased mRNA expression of PROK1 and LIF could be one of the several abnormalities characterizing the endometrium in women recurrent pregnancy loss. PMID: 25128195
  39. Addition of leukemia inhibitory factor (LIF) neutralizing antibodies inhibited oligodendrocyte differentiation, indicating a crucial role of TNFR2-induced astrocyte derived LIF for oligodendrocyte maturation PMID: 24310780
  40. Data from 3-year-old girl and other reported cases support model in which abundance of LIF in B-cell acute lymphoblastic leukemia results in leukemic infiltration of central nervous system and development of Cushing syndrome. [CASE STUDY; REVIEW] PMID: 23729555
  41. This mini review will summarize the findings that are related to LIF signaling and discuss the neuroprotective effects of LIF in different models. PMID: 24664722
  42. Data suggest LIF/LIF receptor (alpha subunit) signal transduction facilitates blastocyst implantation or development of tubal pregnancy by stimulating blastocyst adhesion and outgrowth/proliferation of placenta or Fallopian tube epithelial cells. PMID: 24074901
  43. Polyethylene glycated leukemia inhibitory factor antagonist inhibits human blastocyst implantation and triggers apoptosis by down-regulating embryonic AKT1. PMID: 23876532
  44. NPC patients had increased serum levels of LIF. Higher LIF levels correlated with local tumor recurrence. Xenograft mouse studies showed that LIF critically contributes to NPC tumor growth & radioresistance. PMID: 24270418
  45. study found lower expression of LIF in the edndometrium in unexplained infertile women with multiple implantation failures compared to fertile women; data suggest that the initial lower expression of LIF in proliferative phase may be one of the causes for multiple failure of implantation PMID: 23541977
  46. novel expression and purification protocol for the production of recombinant hLIF PMID: 23628981
  47. In summary, we can show that LIF is an important factor in melanoma progression. PMID: 23831429
  48. Data show that the expressions of ER-alpha, PR, LIF, VEGF, iNOS and CB1 in fallopian tube and chorionic villi of tubal pregnancy were not altered by exposure to levonorgestrel emergency contraception. PMID: 23687977
  49. LIF is a contraction-induced myokine, potentially acting in an autocrine or paracrine fashion to promote skeletal muscle satellite cell proliferation. PMID: 21527666
  50. No correlation was found between pinopodes development stage and LIF expressions in endometrium. PMID: 22252755

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
LIF/OSM family
Database Links

HGNC: 6596

OMIM: 159540

KEGG: hsa:3976

STRING: 9606.ENSP00000249075

UniGene: Hs.2250

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*