Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human SSTR2 at 10 μg/mL can bind Anti-SSTR2 recombinant antibody (CSB-RA022725MA01HU), the EC50 is 58.13-81.28 ng/mL.②Blocking experiment on Anti-SSTR2 antibody (CSB-RA022725MA01HU) between Human SSTR2-VLPs protein and CT26/Human SSTR2 Stable Cells (CSB-SC022725HU) by Flow cytometry.
Alternative Names
(SS-2-R)(SS2-R)(SS2R)(SRIF-1)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
1-369aa
Target Protein Sequence
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged (This tag can be tested only under denaturing conditions)
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Human SSTR2 recombinant protein was produced in mammalian cell, where the gene sequence encoding Human SSTR2 (1-369aa) was expressed with the C-terminal 6xHis tag. The activity of this recombinant protein was measured in a functional ELISA. In addition, this recombinant human SSTR2 protein was developed through the Virus-Like Particles (VLPs) Platform. It is a seven-pass transmembrane protein.
SSTR2 (Somatostatin receptor 2) is a subtype of the SSTR family, which belong to the G protein-coupled receptor (GPCR) superfamily. SSTR2 is mainly involved in the regulation of various neuroendocrine processes, which can inhibit cell proliferation and promote cell apoptosis, and is an important target of neuroendocrine tumors. Most neuroendocrine tumors and their metastases express more SSTR than normal tissues. SSTR messenger RNA isoforms are widely expressed in neuroendocrine tumors, and their distribution is unnecessarily linked to the expression of SSTR isoforms. SSTR subtypes display a specific subcellular localization in human SS receptor-positive tumors. Most tumors with amine precursor absorption and decarboxylation characteristics and tumors with neuroendocrine characteristics have a large number of SSTR subtypes, but SSTR2 is the most expressed. Most human endocrine gland tumors, such as gastrinomas, glucagonomas, vasodilatory intestinal peptide tumors, and nonfunctional islet cell tumors, express SSTR2.