Home
Active Protein
Other
Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active)

Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active)

^{In Stock}

Code	CSB-MP023996HU1
MSDS	MSDS
Size	$228
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized CD30(CSB-MP023983HU1h6) at 5 μg/ml can bind human CD30L, the EC₅₀ is 9.531-12.49 ng/ml. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized CD30(CSB-MP023983HU1h6) at 5 μg/ml can bind human CD30L, the EC₅₀ is 9.531-12.49 ng/ml.

Target Names

TNFSF8

Uniprot No.

P32971

Alternative Names

TNFSF8; CD30L; CD30LG; Tumor necrosis factor ligand superfamily member 8; CD30 ligand; CD30-L; CD antigen CD153

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

63-234aa

Target Protein Sequence

QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

Mol. Weight

21.8 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Human TNFSF8 amino acids Gly21-Glu147 with N-terminal 6xHis-tag were expressed in mammalian cells. The resulting product is the recombinant human TNFSF8 protein. This TNFSF8 protein was validated by SDS-PAGE analysis, and its purity is greater than 85%. It migrated to the molecular mass band of about 22 kDa on the gel. Its endotoxin level is less than 1.0 EU/ug determined by the LAL method. This TNFSF8 protein can bind to the immobilized CD30 in the functional ELISA, with an EC₅₀ of 9.531-12.49 ng/ml. It shows the TNFSF8 is an active protein. And it is available now.

TNFSF8, also called CD30L or CD153, is primarily expressed on activated T and B cells eosinophils, and macrophages. CD30L/CD30 signaling is involved in Th1, Th2, Th17 cell responses, and Th1-, and Th2- associated diseases.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

5.0 - 1 reviews

Submit a Review here

Applications : Binding assay/Protein-protein interaction

Review: TNFSF8, also known as CD30L or CD153, is mainly expressed on activated T cells and B cells eosinophils, and macrophages. The CD30L/CD30 signaling pathway is involved in Th1, Th2, and Th17 cell responses, as well as Th1- and Th2- related diseases. CD30L and CD30 have good binding activity, and a stable screening system has been established through high-throughput screening using an ELISA method.

By Anonymous

Target Background

Function

Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.

Gene References into Functions

circulant sCD30L is functionally active and that it may favor persistence of active inflammation by inducing apoptosis of CD30(+)T cells, known to down-modulate inflammation in rheumatoid synovitis. PMID: 24447865
TNFSF8 is an important leprosy T1R susceptibility gene. PMID: 25320285
The heritability of IgA levels is moderate and can partly be attributable to common variation in the CD30L locus. PMID: 24676358
The TNFSF8 polymorphisms rs927374 and rs2295800 were associated with neutrophil count. This finding suggests that post-MI inflammatory response is genetically modulated. PMID: 22033252
Positional candidate gene screening in the SPA2 locus allowed us to identify and replicate an association between a rare SNP located in TNFSF8 and spondylarthritis. PMID: 21480186
a possible role of novel TNFSF8 variants in susceptibility to lung cancer. PMID: 21292647
capability to up-regulate expression of CD30, release of soluble CD30 and production of IL-4 in pre-activated T cells upon co-culture PMID: 11728464
Mast cells were found to be the predominant CD30 ligand-positive (CD30L-positive) cell in the chronic inflammatory skin diseases psoriasis and atopic dermatitis. PMID: 16964309
CD153 antigen was expressed by synovial mast cells, and correlated with serum levels, in Rheumatoid Arthritis patients PMID: 19208589
Single nucleotide polymorphism in TNFSF8 gene is associated with bone disease in myeloma. PMID: 19657367