Code | CSB-EP022812HU |
Size | $224 |
Order now | |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Discover the power of our premium Recombinant Human STAT3 protein, a vital tool for researchers investigating the signal transducer and activator of transcription 3, also known as the acute-phase response factor. STAT3 is a key player in numerous cellular processes, including cell growth, apoptosis, and immune response, making it an essential target for scientific exploration across various research areas.
Our Recombinant Human STAT3 protein is expressed in E.coli, yielding a partial protein (50-240aa) that maintains native structure and function. With an N-terminal 6xHis-SUMO tag, this protein enables efficient purification and detection, ensuring consistent and reliable results for your research. The purity of our Recombinant Human STAT3 protein is greater than 90%, as determined by SDS-PAGE, providing you with the quality needed for your experiments. Choose between liquid and lyophilized powder formats to best suit your research requirements.
Applications : Western blot assays and Surface Plasmon Resonance (SPR) experiments
Review: Compound 4m inhibited STAT3 phosphorylation in HCT-116. The HCT-116 were serum-starved overnight, then left untreated or treated with CEL (1.0 lM) and 4m (0.5, 0.75, 1.0 lM) for 6 h, followed by stimulation by IL-6 (25 mg/mL). The cells were harvested at 30 min and analysed by Western blot assays.
By Anonymous
Applications : SPR analysis of CEL-2 to recombinant human STAT3 protein
Review: CEL-2 effectively decreased the level of p-STAT3 at site pTyr705 in a concentration-dependent manner, and the inhibitory effect of CEL-2 was stronger than CEL at 0.75 lM. However, the total level of STAT3 was not changed with CEL-2 treatment.
By Anonymous
I am interested in several of your recombinant proteins. Can you please provide some informations:
For CSB-EP022812HU (all expression systems):
a.Sequence
b.Tag type
c.Tag position
d.Sizes and formats
e.Is the protein provided soluble in solution?
f.Is the protein purified from bacterial inclusion bodies are you supplied refolded or still in urea?
g.I want to use this protein for conjugation purposes and need it supplied in an amine free buffer (so not Tris). Can you supply this protein in one of the buffers at my request: phosphate, carbonate, or borate? Would there be an extra charge?
ESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM